SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000023998 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000023998
Domain Number 1 Region: 276-409
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.54e-36
Family Eukaryotic proteases 0.00079
Further Details:      
 
Domain Number 2 Region: 193-289
Classification Level Classification E-value
Superfamily SRCR-like 9.42e-19
Family Hepsin, N-terminal domain 0.024
Further Details:      
 
Domain Number 3 Region: 172-196
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000825
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000023998   Gene: ENSCJAG00000013052   Transcript: ENSCJAT00000025386
Sequence length 456
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:15502134:15513339:-1 gene:ENSCJAG00000013052 transcript:ENSCJAT00000025386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRGAADALPSQNAPPARTSSARVSPAQASPAGTPPGQTSPGQASPARASPARASPTRASP
AQTSASRSSSSRSSSARSASVTASPTRVYLVRATPVGAVPTRPSPARSAPAARATRESSG
TSLPKFTWREGQKRLPLIGCVLLLITLVVSLIILFHFWRGHTGIRYKEQRESCPKHAVRC
DGVVDCKLKSDELGCVRFDWDKSLLKIYSESSHQWLPICSSNWNDSYSEKTCQQLGFESA
YRTTEVAHRDFANSFSISRYNSTIQESLHRSECPSQRYISLQCSHCGLRAMTGRIVGGAL
ASESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKILEGWKVYAGTSNLHQL
PEAASIAEIIINSNYTDEQDDYDIALMRLSKPLPLSGERICTPPTPQLQHPLQPLTLSAS
VNSYAAPKASAWQKTLKDPCLEHFCLIGETDAQGLY
Download sequence
Identical sequences F7E2J8
ENSCJAP00000023998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]