SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024113 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000024113
Domain Number - Region: 18-174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024113   Gene: ENSCJAG00000013127   Transcript: ENSCJAT00000025507
Sequence length 455
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:166287303:166335643:1 gene:ENSCJAG00000013127 transcript:ENSCJAT00000025507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IACSLFLLRFNKKANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRL
GDEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERL
NQELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSK
GQGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQ
HQRQTNKILGNRVAELEKKLRTLEVSGLWSLPAGGKDTILFSDPTLPSGQRSRSPLLKFV
EQPPENKVDPKDGEAQKQEGDESCAAAEALTAPEDARRPTVNSPPNQSCGNQSKLFHSSL
PQLPCEGEVNSLGREIIKLTKEQAAAELEEVRRESPIEGHRSETRPALQGLAAQGKLPTS
HLDSFETSQPAAEAPALEDGEEIPEGSGMRSTTKT
Download sequence
Identical sequences F7E6W7
ENSCJAP00000024113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]