SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024118 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000024118
Domain Number - Region: 17-173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0187
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024118   Gene: ENSCJAG00000013127   Transcript: ENSCJAT00000025512
Sequence length 453
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:166263856:166335231:1 gene:ENSCJAG00000013127 transcript:ENSCJAT00000025512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIHHFLLKRKQANLAQLLRDSQDRNKHLGEEIKELQQRLGEVQGDNKLLRMTIAKQRLG
DEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDVKEERSSYQDKVERLN
QELNHILSGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNIAKYKNALERRKNSKG
QGKSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLATALLETIHEKNMVIQH
QRQTNKILGNRVAELEKKLRTLEVSGLWSLPGGKDTILFSDPTLPSGQRSRSPLLKFVEQ
PPENKVDPKDGEAQKQEGDESCAAAEALTAPEDARRPTVNSPPNQSCGNQSKLFHSSLPQ
LPCEGEVNSLGREIIKLTKEQAAAELEEVRRESPIEGHRSETRPALQGLAAQGKLPTSHL
DSFETSQPAAEAPALEDGEEIPEGSGMRSTTKT
Download sequence
Identical sequences F7E6T9
ENSCJAP00000024118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]