SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Callithrix jacchus 76_3.2.1 > ENSCJAP00000024166

Domain assignment for ENSCJAP00000024166 from Callithrix jacchus 76_3.2.1

Domain architecture

Domain assignment details

No Significant Hits.

Weak hits

Sequence:	ENSCJAP00000024166
Domain Number -	Region: 55-78
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.00667
Family	CCCH zinc finger	0.0056
Further Details:

Domain Number -	Region: 182-211
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0235
Family	CCCH zinc finger	0.0076
Further Details:

Domain Number -	Region: 87-124
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0353
Family	CCCH zinc finger	0.0051
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCJAP00000024166 Gene: ENSCJAG00000013151 Transcript: ENSCJAT00000025563
Sequence length	252
Comment	pep:known_by_projection chromosome:C_jacchus3.2.1:12:1457924:1477036:-1 gene:ENSCJAG00000013151 transcript:ENSCJAT00000025563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	RYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRDGTFNYSPDVYCSKYN EATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAFAHGPL DLRPPVCDVRELQAQEALQNGQLGSGDGVPDLQPGVLASQAMIEKILSEDPRWQDASFVL GSYKTEQCPKPPRLCRQGYACPHYHNSRDRRRNPRTFQYSWRPRHPVLRLSPGACTPRLA LPRVHAGPSSTA
Download sequence
Identical sequences	F7HJB0 ENSCJAP00000024166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]