SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024356 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024356
Domain Number 1 Region: 12-149,180-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-74
Family Calponin-homology domain, CH-domain 0.0000337
Further Details:      
 
Domain Number 2 Region: 7984-8139
Classification Level Classification E-value
Superfamily Spectrin repeat 2.52e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8386-8500
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7764-7888
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-18
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 1634-1768
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-18
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 3127-3283
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-17
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 3281-3401
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-17
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 8 Region: 6903-7043
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 9 Region: 7356-7487
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 10 Region: 4439-4596
Classification Level Classification E-value
Superfamily Spectrin repeat 2.43e-16
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 11 Region: 3749-3897
Classification Level Classification E-value
Superfamily Spectrin repeat 4.11e-16
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 12 Region: 7018-7159
Classification Level Classification E-value
Superfamily Spectrin repeat 5.37e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 13 Region: 2469-2599
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000245
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 14 Region: 4221-4377
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000798
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 15 Region: 6692-6832
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000156
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 1415-1549
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000624
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 17 Region: 2687-2812
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 567-709
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000176
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 7283-7390
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000113
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 20 Region: 7892-8002
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 21 Region: 2257-2412
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000192
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 22 Region: 4979-5135
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000228
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 23 Region: 7554-7705
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000243
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 24 Region: 8463-8609
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000027
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 25 Region: 2841-2958
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000547
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 26 Region: 5861-5999
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000127
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 27 Region: 5665-5740,5851-5897
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000393
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 28 Region: 1933-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000377
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 29 Region: 4892-4988
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000533
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 30 Region: 2060-2199
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000732
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 31 Region: 1722-1874
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000935
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 32 Region: 1510-1630
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000134
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 33 Region: 3470-3575
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000202
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 34 Region: 3398-3502
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000368
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 35 Region: 1097-1235
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000921
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 36 Region: 5529-5620
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000101
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 37 Region: 3907-4065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000114
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 38 Region: 5105-5211
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000198
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 39 Region: 5450-5566
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000262
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 40 Region: 4138-4266
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000484
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 41 Region: 6487-6570
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000103
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 42 Region: 3577-3687
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000216
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 43 Region: 3038-3139
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000024
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 44 Region: 6009-6123
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000806
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 45 Region: 6310-6415
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000017
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 46 Region: 897-1023
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000313
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 47 Region: 4572-4704
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000759
Family Spectrin repeat 0.018
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000024356
Domain Number - Region: 4808-4919
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000114
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number - Region: 6583-6686
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00178
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 4040-4140
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00406
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 8283-8397
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0192
Family Spectrin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024356   Gene: ENSCJAG00000012842   Transcript: ENSCJAT00000025760
Sequence length 8749
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:153039024:153567660:-1 gene:ENSCJAG00000012842 transcript:ENSCJAT00000025760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRGTSRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTD
IADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSLVSSETPSPPSKRKVT
TKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLEKVKGR
SNRENLEDAFSIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNVGTDGQ
EDDEILPGFPSFANSIQNFKREDRLILKEVKVWIEQFERDLTRAQMVESNLQDKYQSFKH
FRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQSWDRVSSRLCDWHIHLDKSLPAPLGT
IGAWLYRAEVALREEITIQQVHEETANMIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVN
GIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRR
ESVEQLLQNYVSFIENSKFFEQYEVTYQILKQTAEMYIKADGSVEEAENVMKFMNETTAQ
WRNLSVEVRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHW
IQQHTAMNDAGNFLIETCNEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEY
TDCIVTLSAFATESHKKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMEAQYKIITKTAHLI
TKESPQEEGKEMFATMSKLKEQLTKVKECYSPLLYECQQLLIPLEELEKQMTSFYDSLGK
INEIITVLEHEAQSSALFKQKHQELLACQDNCKKTLTLIEKGSQSVQKFVTLSNVLKHFD
QTRLQRQIADVHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEK
GDPEELLRRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQG
EAPYHLLHLKIDVEKNRFLASVEECRAELDRETKLVPQEGSEKIIKEHRVFFSDKGPHHL
CEKRLQLIEELCVKLPVRDPVRDTPGTCHATLKDLRAAIDSTYRKLMEDPDKWKDYTSRF
SEFSSWISTKETQLKGIKGEAIDTANHGEVKCAAEEIRTGITKRGETLSWLKSRLKVLTE
VSSENEAQKQGDELATLSSSFKALSALLSEVEKMVSNFGDCVQYKEIVKNSLEELISGSK
EAQEQAEKILDTENLFEAQQLLLHHQQKTKRISAKKKDVQQQIAQAQQGETGLPDRSREE
LQKLESTLDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLE
SLSSELEQTKEFSKRTESIAVQAENLVKEASEVPLGPQNKQLLQQQAKSIKEQVKKLEDT
LEEDIKTMEMVKTKWDHFGSNFETLSAWITEKEKELNGLETSSSAMDMQISQIKVTIQEI
ESKLSSIIGLEEEAQSFAQFVTTGESARIKAKLTQIRRYWEELREHAQCLEGTILGHLSQ
QQKFEENLRKIQQSVSEFEDKLAVPIKTCSSATETYKVLQEHMDLCQALESLRSPITAFS
ASARKVVNGDSCVQEAAALQQQYEGTLRKAKERQTALENLLAHWQRLEKELSSFLTWLER
CEAIASSPEMDISADRVKVESELQLIQALQNEVVSQASFYSKLLQLKESLFSVASKEDVK
MLKLHLEQLDERWRDLPQIINKRINFLQSVVSEHQQFDELLLSFSIWIKLFLSELQATSE
ISIIDHQVALTRHKDHTADVESKKGELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLF
EEASQVVERRQLALSHLAEFLQSHASLSSVLHKLRQTVEATNSMNKNQSDLIEKNLNDAI
QDAKALESTAVSLDGILSKAQYHLKSGSSEQRTSCRATVDQLFGELERIQNLLGTKQSEA
DALAVLKKAFQDQKEELLKSIENIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEH
ELCWLKDKAKQIAQKDVAFAPEVDREINRLEVTWDDTKRLIHENQGQCCGLIDLMREYQN
LKSAVSKVLENASSVIVTRTTIKDQEDLKWAFSKHETARNKMNYKQKDLDNFTSKGKHLL
SELKKIHSSDFSLVKTDMESTMDKWLDVTEKLEENMDRLRVSLSIWDDVLSSKDEIEGWS
NNSVPQMAENISNLSNHRRAEELLKEFESEVKNKALRLEELHSKVNDLKNLTKNPETPPD
LRFIEADLRQKLEHAKEITEVAKGTLKDFTAQSTQVEKFINDVTTWLTKVEESLMNCAQT
ETCEGLKKVKDIQKELQSQQSNISSTQENLNSLCRKYHSAELESLGRAMTGLIKKHEAVS
QLCSKTQASLQDSLEKHFSESMQEFQEWFLGAKAAAKELSDRTGDSKVLEAKLQDLQNIL
DSVSDGQSKLDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDC
ASELGSFEDQHRKLNLWIHEMEERLNTENLGESKQHIPEKKNEVHKVEMFLGELLAARES
LDKLSQRGQLLSEEGHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEAL
QSMWSWVKVIQDRLACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALR
SSNKEGQRVIQTQLETLKEVWADIMSSSIHAQSTLESVISQWNAYLERKNQLEQWMESVD
QKVEHPLQPQPGLKEKFTLLDHLQSVLSEAEDHSRALHRLNAKSRELYEKTGDESFKDTA
QEELKTQFTDIMTVAKEKMRKVEEIVKDHLMYLDAVQEFTDWLQSAKEELHRWSDMSGDS
SATQKKLSKIKELIDSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQW
EDSVFQTQNRLEDLVSQMALSEQEFSGQVAQLEQALEEFSALLKTWAQHLTLLEGKNTDE
EIVECWHKGQEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQ
ASKGCQNKEQILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLLE
SENGQHKLNMMLSKGELLSTLLAKEKAKGIQAKVAAAKEDWKNFHSSLHQKESALENLKI
QMKDFEVSAEPIQDWLSKTEKMVQESSNRLYDLPAKRREQQKLQSVLEEIQCYEPQLNRL
KEKAQQLWEGQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQ
DWMTDAIHMLDSYCHPTSDKSVLDSRMLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSP
EGIPTIQQQLQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDDVRQFSGWMDSMETNLH
ESERQHAELRDKIAMLGKAKLLNEEVLSYSSLLETIEVKGAGMTGHYVTQLELQDLQERY
RAIQERAKETVTKSEKLVRLHQEYQRDLKAFEAWLGQEQEKLDKYSVLEGDAHTHETTLR
DLQELQVHCAEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQAYQHRLSETRTHF
NNVVNKLRLMEQKFQQVEEWLKTAEEKKWHEEVTAYRDEVEEVGARAQEILDESHVSSRM
GCQATQMTSRYQALLLQVLEQVKSLEEEIQSLEESESSLSSYSDWYGSTHKNFKNVATKI
DKADTAMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEESEAERLRKEIHDHVE
QLKELTSTVRKEHMTLEKGLHLAKEFSDKCKALTQWIAEYQEILHVPEEPKMELYEKKAQ
LSKYKSLQQMVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQSDYQDLCSAGKAMME
EIAGFEDRLNNLQMKGDALIGQCADHLQVKLKQNVHAHVQGTKDSYSAICSTAQRVYQSL
EHELQKHVSRQDTLQQCQAWLSAVQPDLQPSPQPPLSRAEAVKQVKHFRALQEQARTYLD
LLCSMCDLSNASVKTTAKDIQQTEQMIEQRLVQAQNLTQGWEEIKHLKAELWIYLQDADQ
QLQNMKRRHSELELNIAQNMVSQVKDFVKKLQSKQASVNTIIEKVNKLTEKEESPEHKEI
NHLNDQWLDLCHQSNNLCLQREEDLQRTRNYHDCMNVVEAFLEKFTTEWDNLARSDAEST
AVHLEALKKLALALQERKHAIEDLKDRKQKMIEHLNLDDKELVKEQTSHLEQRWFQLEDL
IKRKIQVSVTNLEELNVVQSRFQELMEWAEEQQPSITEALKQSPPPEMAQNLLMDHLAIC
SELEAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQRHVNCLSDLVGQRRKYLNKA
LSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVNKQVKTCKSAQASLKTYQNEVT
GLWAQGRELMKGVTEQEKGEVLGKLQELQSVYDSVLQKCSHRLQELEKNLVSRKHFKEDF
DKACHWLKQADIVTFPEINLMNESAELHTQLAKYQHILEQSPEYENLLLTLQRTGQTILP
SLNEVDHSYLSEKLNALPQQFNVIVALAKDKFYKVQEAILARKEYASLIELTTQSLSELE
AQFLGLSKVPTDLAVEEASSLQDGCRAILDEVVGLGEAVDELNQKKEGFRSTGQPWQPDK
MLHLVTLYHRLKRQAEQRVSLLEDTTSAYQEHEKMCRQLERQLKSVKEEQSKVNEETLPA
EEKLKMYHSLAGSLQDSGILLKRVAIHLEDLAPHLDPLAYEKARNQIQSWQEELKLLTSA
IGETVTECESRMVQSIDFQTEMSHSLDWLRRVKAELSGPLSLDLNLQDIQEEIRKIQIHQ
EEVQSSLRIMNALSHKEKEKFTKAKELISVDLEHSLAELSELDGDIQEALRTRQATLTEI
YSQCQRYYQVFQAANDWLEDAQEMLQLAGNGLDVESAEENLKSHMEFFSTEDQFHSNLEE
LHGLVATLDPLIKPTGKEDLAQKMASLELRSQRMSQDSCAQVDILQRCAAQWQDYQKSRE
EVIELMNDTEKKLSEFSLLKTSCSHEAEEKLSEHKALVSVVNSFHEKIVALEDKALQLEK
TGNDASKAALSRSMTTVWQRWTRLRVVAQDQEKILEDAVDEWKGFNNKVKKATEMIDQLQ
DKLPGSSAEKASKAELLTLLEYHDTFVLELEQQQLALGMLRQQALSMLQDGALPTPGGEP
HLTQEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQETKEYLGNPTI
EIDAQLEELQILLTEATNHRQNIEKMAEEQKDKYLSLYTILPSELSLQLAEVALDLKIRD
QIQDRIKEVEQSKAMSQELSRQIQKIAKDLTTILTKLKAKTDNLVQAKTDQKVLGEELDD
CNSKLMELDAAVQKFSERNGQLGKPLVRKVGKLTELHQQTSRQAENRLSKLNQAASHLEE
YNEMLELILKWIEKAKVLAHGNIVWNSASQLREQYILHQTLLEESKEIHCDLEAMTEKLH
YLTSVYCTEKMSQQVAELGRETEELQQMIKIRLQNLQDAAKDMKKFEAELKKLQAALEQA
QATLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPEDVVASLPLCHA
ALRLQEEASRLQHTAIQQCNIMQAAVVQYEQYEQEMKHLQQLIEGAHREIEDKPVATSNI
QELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTEVEGLAEGTEDL
DGELLPAPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACRSPSPVANTDAS
VNQDIAYYQALSAERLQTDAAKIHPSTSTSQEFYEPGLEPSATAKLGDLQRSWETLKNVI
SEKQRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPELGRSPESQMAEHQALMDEIL
MLQDEINELQSSLAEELVSESCEADPAEQLALQSTLTVLAERMSTIRMKASGKRQLLEEK
LNDQLEEQRQEQALQRYRCEADELDSWLLSTKATLDIALGTPKEPMDMEAQLVDCQNMLV
EIEQKVVALSELSVHNENLMLEGKAHTKDEAEQLAGKLRRLKGSLLELQRALHDKQLNMQ
GTAQEKEESDVDLTATQSPGVQEWLAQARTTRTHQRQSSLQQQKELEQELAEQKSLLRSV
ASRGEEILIQHSAAETSGGAGEKPDALSQELGMEGEKSSTEDQMRMKWESLHQEFSTKQK
LLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDVPTQDKSAVTSLLDGLNQAFEEVSSQSGG
TKRQSIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLFNQEILAKDIKEMSE
EMDKNKHLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCHQMKERLQQILNFQN
DLKVLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKELDAGIIELKRRGDKLQ
IEQPSMQELSKLQDMYDELMMTIGSRRSGLNQNLTLKSQYERALQDLADLLETGQEKMAG
DQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVQKETQFHTELMAQAS
AVLKRAHKRGVELEYILETWSHLDEDQQELSRQLEVVESSIPSVGLVEENEDRLIDRITL
YQHLKSSLNEYQPKLYQVLDDGKRLLISITCSDLESQLNQLGEHWLSNTNKVSKELHRLE
TILKHWTRYQSESADLIHWLQSAKDRLEFWTQQSVTVPQELEMVRDHLNAFLEFSKEVDA
KSSLKSSVLSTGNQLLRLKKVDTATLRSELSHIDSQWTDLLTNIPAVQEKLHQLQMDKLP
SRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYKGFKIDINCKQLTVDFVN
QSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQLLEGLLESWSEYENNV
QCLKTWFETQEKRLKQQHRIGDQASVQNALKDCQDLEDLIKAKEKEVEKIEQNGLALIQN
KKEDVSGVVMSTLRELGQTWANLDQMVGQLQILLKSVLDQWSNHKAAFDEINSYLMEARY
SLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQETSLQKFGSITNQLLKECQPPVTETLTN
TLKEVNMRWNNLLEEIAEQLHSSKALLQLWQRYKDYSKQCSSMVQQQEDRTNELLKAATN
KDIADDEVATWIQDCNDLLKGLGTVKDSLFVLHELGEQLKQQVDASAASAIQSDQLSLSQ
HLCALEQALCKQQTALQAGVLDYETFAKSLEALEAWIVEAEEILQGQDPSHSSDLSTIQE
RMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLISSQTTERFSKL
QSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELFQAEMFSRQQIL
HSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDSQIRQWQRYREM
AEKLRKWLVEVSYLPTSGLGSVPIPLQQARTLFDEVQFREKVFLRQQGSYILTVEAGKQL
LLSADSGAEAALQDELTEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEKGIADSLEKLRT
FKKQLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLTLLKDTLSAYISADDISILN
ERIELLQRQWEELCHQLSLRRQQISERLNEWAVFSEKNKELCEWLTQMESKVSQNGDILI
EEMIEKLRKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLGKVNDRWQHLLD
LIAARVKKLKETLVAVQQLDKNMSILRTWLAHIESELAKPIVYDSCNSEEIQRKLNEQQE
LQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRWRNICAMSMERR
LKIEETWRLWQKFLDDYSRFEDWLKISERTAAFPSSSGVIYTVAKEELKKFEAFQRQVHE
CLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVTSILRRLKHFIGQRE
EFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNHNKIEQIIAQGE
QLIEKSEPLDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDEHDLSDRELELED
SAALSDLHWQDRSADSVLSPQPSSNPSLSLAQPLRSERSGRDTPASVDSIPLEWDHDYDL
SRDLESAVSRALPSEDEDGQDDKDFYLRGAVGLSDVMIPESPEAYVKLTENAIKNTSGDH
SALESQIRQLGRALDESRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSGSIDSVK
RLEHKLKEEEESLPGFVNLHSTETQMAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSD
LNSIWAWLGDTEEELEHLQHLELSTDIHTIELQIKKLKELQKAVDHRKAIILSINLCSPE
FTQADSKESQDLQDRLSQMNGRWDRVCSLLEEWRGLLQDALMQCQGFHEMSHGLLLMLEN
IDRRKNEIVPIDPNLDAEVLQDHHKQLMQIRRELLESQLRVASLQDMSCQLLVNAEGADC
LEAKEKVHVIGNRLKLLLKEVSRHIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTS
GRSTPNRQKTPRGKCSLSQPGPSVSSPHSRSTKGGFDSSLSEPGPARSGRAFLFRVLRAA
LPLQLLLLLLIGLACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences F7H364
ENSCJAP00000024356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]