SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024387 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024387
Domain Number 1 Region: 12-142,173-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.01e-78
Family Calponin-homology domain, CH-domain 0.0000295
Further Details:      
 
Domain Number 2 Region: 8055-8210
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-21
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 3 Region: 8434-8548
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-19
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 7835-7959
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-18
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 5 Region: 1627-1761
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-18
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 3120-3276
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-17
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 3274-3394
Classification Level Classification E-value
Superfamily Spectrin repeat 4.2e-17
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 8 Region: 6974-7114
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-17
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 9 Region: 7427-7558
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 10 Region: 4510-4667
Classification Level Classification E-value
Superfamily Spectrin repeat 2.65e-16
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 11 Region: 7089-7230
Classification Level Classification E-value
Superfamily Spectrin repeat 5.5e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 2462-2592
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000245
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 13 Region: 3892-4032
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000314
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 14 Region: 4292-4448
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000089
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 15 Region: 6763-6903
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000156
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 16 Region: 3764-3885
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000339
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number 17 Region: 1397-1542
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000708
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 18 Region: 560-702
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000176
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 19 Region: 2680-2805
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000018
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 20 Region: 3570-3702
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000011
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 21 Region: 7354-7461
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000114
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 22 Region: 7963-8073
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 23 Region: 2250-2405
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000192
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 24 Region: 5050-5206
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000228
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 25 Region: 7625-7776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000243
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 26 Region: 8511-8657
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000306
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 27 Region: 2834-2951
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000557
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 28 Region: 5932-6070
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000128
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 29 Region: 5736-5811,5922-5968
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000393
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 30 Region: 3383-3495
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000272
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number 31 Region: 1926-2077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000377
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 32 Region: 4963-5059
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000533
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 33 Region: 1714-1867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000719
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 34 Region: 2053-2192
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000744
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 35 Region: 3463-3568
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000017
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 36 Region: 1090-1228
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000095
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 37 Region: 5600-5691
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000102
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 38 Region: 1519-1623
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000192
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 39 Region: 5176-5282
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000198
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 40 Region: 5521-5637
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000249
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 41 Region: 4209-4337
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000314
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 42 Region: 6558-6641
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000103
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 43 Region: 3031-3132
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000272
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 44 Region: 4004-4136
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000602
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 45 Region: 6080-6194
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000806
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 46 Region: 6381-6486
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000017
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 47 Region: 890-1016
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000317
Family Spectrin repeat 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000024387
Domain Number - Region: 4879-4990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000115
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number - Region: 4669-4781
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00115
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 6654-6757
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00178
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 4123-4225
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00314
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 8331-8445
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0216
Family Spectrin repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024387   Gene: ENSCJAG00000012842   Transcript: ENSCJAT00000025795
Sequence length 8797
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:153039024:153568198:-1 gene:ENSCJAG00000012842 transcript:ENSCJAT00000025795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSRGTSRCPRDIANVMQRLQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDG
VKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKIKLVNINSTDIADGRPS
IVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSLVSSETPSPPSKRKVTTKIQGNA
KKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLEKVKGRSNRENLE
DAFSIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNVGTDGQEDDEILP
GFPSFANSIQNFKREDRLILKEVKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEM
KRKQIEHLIQPLHRDGKLSLDQALVKQSWDRVSSRLCDWHIHLDKSLPAPLGTIGAWLYR
AEVALREEITIQQVHEETANMIQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPD
QLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLL
QNYVSFIENSKFFEQYEVTYQILKQTAEMYIKADGSVEEAENVMKFMNETTAQWRNLSVE
VRSVRSMLEEVISNWDRYGNTVASLQAWLEDAEKMLNQSENAKKDFFRNLPHWIQQHTAM
NDAGNFLIETCNEMVSRDLKQQLLLLNGRWRELFMEVKQYAQADEMDRMKKEYTDCIVTL
SAFATESHKKLSEPLEVSFMNVKLLIQDLEDIEQRVPVMEAQYKIITKTAHLITKESPQE
EGKEMFATMSKLKEQLTKVKECYSPLLYECQQLLIPLEELEKQMTSFYDSLGKINEIITV
LEHEAQSSALFKQKHQELLACQDNCKKTLTLIEKGSQSVQKFVTLSNVLKHFDQTRLQRQ
IADVHVAFQSMVKKTGDWKKHVETNSRLMKKFEESRAELEKVLRIAQEGLEEKGDPEELL
RRHTEFFSQLDQRVLNAFLKACDELTDILPEQEQQGLQEAVRKLHKQWKDLQGEAPYHLL
HLKIDVEKNRFLASVEECRAELDRETKLVPQEGSEKIIKEHRVFFSDKGPHHLCEKRLQL
IEELCVKLPVRDPVRDTPGTCHATLKDLRAAIDSTYRKLMEDPDKWKDYTSRFSEFSSWI
STKETQLKGIKGEAIDTANHGEVKCAAEEIRTGITKRGETLSWLKSRLKVLTEVSSENEA
QKQGDELATLSSSFKALSALLSEVEKMVSNFGDCVQYKEIVKNSLEELISGSKEAQEQAE
KILDTENLFEAQQLLLHHQQKTKRISAKKKDVQQQIAQAQQGETGLPDRSREELQKLEST
LDGLERSRERQERRIQVTLRKWERFETNKETVVRYLFQTGSSHERFLSFSSLESLSSELE
QTKEFSKRTESIAVQAENLVKEASEVPLGPQNKQLLQQQAKSIKEQVKKLEDTLEEDIKT
MEMVKTKWDHFGSNFETLSAWITEKEKELNGLETSSSAMDMQISQIKVTIQEIESKLSSI
IGLEEEAQSFAQFVTTGESARIKAKLTQIRRYWEELREHAQCLEGTILGHLSQQQKFEEN
LRKIQQSVSEFEDKLAVPIKTCSSATETYKVLQEHMDLCQALESLRSPITAFSASARKVV
NGDSCVQEAAALQQQYEGTLRKAKERQTALENLLAHWQRLEKELSSFLTWLERCEAIASS
PEMDISADRVKVESELQLIQALQNEVVSQASFYSKLLQLKESLFSVASKEDVKMLKLHLE
QLDERWRDLPQIINKRINFLQSVVSEHQQFDELLLSFSIWIKLFLSELQATSEISIIDHQ
VALTRHKDHTADVESKKGELQSLQGHLAKLGSLGRAEDLHLLQGKAEDCFQLFEEASQVV
ERRQLALSHLAEFLQSHASLSSVLHKLRQTVEATNSMNKNQSDLIEKNLNDAIQDAKALE
STAVSLDGILSKAQYHLKSGSSEQRTSCRATVDQLFGELERIQNLLGTKQSEADALAVLK
KAFQDQKEELLKSIENIEERTDKERLKEPTRQALQQRLRVFNQLEDELNSHEHELCWLKD
KAKQIAQKDVAFAPEVDREINRLEVTWDDTKRLIHENQGQCCGLIDLMREYQNLKSAVSK
VLENASSVIVTRTTIKDQEDLKWAFSKHETARNKMNYKQKDLDNFTSKGKHLLSELKKIH
SSDFSLVKTDMESTMDKWLDVTEKLEENMDRLRVSLSIWDDVLSSKDEIEGWSNNSVPQM
AENISNLSNHRRAEELLKEFESEVKNKALRLEELHSKVNDLKNLTKNPETPPDLRFIEAD
LRQKLEHAKEITEVAKGTLKDFTAQSTQVEKFINDVTTWLTKVEESLMNCAQTETCEGLK
KVKDIQKELQSQQSNISSTQENLNSLCRKYHSAELESLGRAMTGLIKKHEAVSQLCSKTQ
ASLQDSLEKHFSESMQEFQEWFLGAKAAAKELSDRTGDSKVLEAKLQDLQNILDSVSDGQ
SKLDAVTQEGQTLYAHLSKQIVSSIQEQITKANEEFQAFLKQCLKDKQALQDCASELGSF
EDQHRKLNLWIHEMEERLNTENLGESKQHIPEKKNEVHKVEMFLGELLAARESLDKLSQR
GQLLSEEGHGAGQEGRLCSQLLTSHQNLLRMTKEKLRSCQVALQEHEALEEALQSMWSWV
KVIQDRLACAESTLGSKDTLEKRLSQIQDILLMKGEGEVKLNMAIGKGEQALRSSNKEGQ
RVIQTQLETLKEVWADIMSSSIHAQSTLESVISQWNAYLERKNQLEQWMESVDQKVEHPL
QPQPGLKEKFTLLDHLQSVLSEAEDHSRALHRLNAKSRELYEKTGDESFKDTAQEELKTQ
FTDIMTVAKEKMRKVEEIVKDHLMYLDAVQEFTDWLQSAKEELHRWSDMSGDSSATQKKL
SKIKELIDSREIGASRLSRVESLAPEVKQNTTASGCELMHTEMQALRADWKQWEDSVFQT
QNRLEDLVSQMALSEQEFSGQVAQLEQALEEFSALLKTWAQHLTLLEGKNTDEEIVECWH
KGQEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQN
KEQILQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLLESENGQHK
LNMMLSKGELLSTLLAKEKAKGIQAKVAAAKEDWKNFHSSLHQKESALENLKIQMKDFEV
SAEPIQDWLSKTEKMVQESSNRLYDLPAKRREQQKLQSVLEEIQCYEPQLNRLKEKAQQL
WEGQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWMTDAI
HMLDSYCHPTSDKSVLDSRMLKLEALLSVKQEKEIQMKMIVTRGESVLQNTSPEGIPTIQ
QQLQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDDVRQFSGWMDSMETNLHESERQHA
ELRDKIAMLGKAKLLNEEVLSYSSLLETIEVKGAGMTGHYVTQLELQDLQERYRAIQERA
KETVTKSEKLVRLHQEYQRDLKAFEAWLGQEQEKLDKYSVLEGDAHTHETTLRDLQELQV
HCAEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQAYQHRLSETRTHFNNVVNKL
RLMEQKFQQVEEWLKTAEEKVGRRTRRQSNRATKEIQLHQMKKWHEEVTAYRDEVEEVGA
RAQEILDESHVSSRMGCQATQMTSRYQALLLQVLEQVKSLEEEIQSLEESESSLSSYSDW
YGSTHKNFKNVATKIDKADTAMMGKKLKTLEVLLKDMEKGHSLLKSAREKGERAVKYLEE
SEAERLRKEIHDHVEQLKELTSTVRKEHMTLEKGLHLAKEFSDKCKALTQWIAEYQEILH
VPEEPKMELYEKKAQLSKYKSLQQMVLSHEPSVKSVREKGEALLELVQDVTLKDKIDQLQ
SDYQDLCSAGKKHVFSLEAKVKDHEDYNSELQEVEKWLLQMSSRLVAPDLLETNSLETIT
QQLAHHKAMMEEIAGFEDRLNNLQMKGDALIGQCADHLQVKLKQNVHAHVQGTKDSYSAI
CSTAQRVYQSLEHELQKHVSRQDTLQQCQAWLSAVQPDLQPSPQPPLSRAEAVKQVKHFR
ALQEQARTYLDLLCSMCDLSNASVKTTAKDIQQTEQMIEQRLVQAQNLTQGWEEIKHLKA
ELWIYLQDADQQLQNMKRRHSELELNIAQNMVSQVKDFVKKLQSKQASVNTIIEKVNKLT
EKEESPEHKEINHLNDQWLDLCHQSNNLCLQREEDLQRTRNYHDCMNVVEAFLEKFTTEW
DNLARSDAESTAVHLEALKKLALALQERKHAIEDLKDRKQKMIEHLNLDDKELVKEQTSH
LEQRWFQLEDLIKRKIQVSVTNLEELNVVQSRFQELMEWAEEQQPSITEALKQSPPPEMA
QNLLMDHLAICSELEAKQMLLKSLIKDADRVMADLGLNERQVIQKALSDAQRHVNCLSDL
VGQRRKYLNKALSEKTQFLMAVFQATSQIQQHERKIMFREHICLLPDDVNKQVKTCKSAQ
ASLKTYQNEVTGLWAQGRELMKGVTEQEKGEVLGKLQELQSVYDSVLQKCSHRLQELEKN
LVSRKHFKEDFDKACHWLKQADIVTFPEINLMNESAELHTQLAKYQHILEQSPEYENLLL
TLQRTGQTILPSLNEVDHSYLSEKLNALPQQFNVIVALAKDKFYKVQEAILARKEYASLI
ELTTQSLSELEAQFLGLSKVPTDLAVEEASSLQDGCRAILDEVVGLGEAVDELNQKKEGF
RSTGQPWQPDKMLHLVTLYHRLKRQAEQRVSLLEDTTSAYQEHEKMCRQLERQLKSVKEE
QSKVNEETLPAEEKLKMYHSLAGSLQDSGILLKRVAIHLEDLAPHLDPLAYEKARNQIQS
WQEELKLLTSAIGETVTECESRMVQSIDFQTEMSHSLDWLRRVKAELSGPLSLDLNLQDI
QEEIRKIQIHQEEVQSSLRIMNALSHKEKEKFTKAKELISVDLEHSLAELSELDGDIQEA
LRTRQATLTEIYSQCQRYYQVFQAANDWLEDAQEMLQLAGNGLDVESAEENLKSHMEFFS
TEDQFHSNLEELHGLVATLDPLIKPTGKEDLAQKMASLELRSQRMSQDSCAQVDILQRCA
AQWQDYQKSREEVIELMNDTEKKLSEFSLLKTSCSHEAEEKLSEHKALVSVVNSFHEKIV
ALEDKALQLEKTGNDASKAALSRSMTTVWQRWTRLRVVAQDQEKILEDAVDEWKGFNNKV
KKATEMIDQLQDKLPGSSAEKASKAELLTLLEYHDTFVLELEQQQLALGMLRQQALSMLQ
DGALPTPGGEPHLTQEITAMQDRCLNMQEKVKTNGKLVKQELKDREMVETQINSVKCWVQ
ETKEYLGNPTIEIDAQLEELQILLTEATNHRQNIEKMAEEQKDKYLSLYTILPSELSLQL
AEVALDLKIRDQIQDRIKEVEQSKAMSQELSRQIQKIAKDLTTILTKLKAKTDNLVQAKT
DQKVLGEELDDCNSKLMELDAAVQKFSERNGQLGKPLVRKVGKLTELHQQTSRQAENRLS
KLNQAASHLEEYNEMLELILKWIEKAKVLAHGNIVWNSASQLREQYILHQTLLEESKEIH
CDLEAMTEKLHYLTSVYCTEKMSQQVAELGRETEELQQMIKIRLQNLQDAAKDMKKFEAE
LKKLQAALEQAQATLTSPEVGRLSLKEQLSHRQHLLSEMESLKPKVQAVQLCQSALRIPE
DVVASLPLCHAALRLQEEASRLQHTAIQQCNIMQAAVVQYEQYEQEMKHLQQLIEGAHRE
IEDKPVATSNIQELQAQISRHEELAQKIKGYQEQIASLNSKCKMLTMKAKHATMLLTVTE
VEGLAEGTEDLDGELLPAPSAHPSVVMMTAGRCHTLLSPVTEESGEEGTNSEISSPPACR
SPSPVANTDASVNQDIAYYQALSAERLQTDAAKIHPSTSTSQEFYEPGLEPSATAKLGDL
QRSWETLKNVISEKQRTLYEALERQQKYQDSLQSISTKMEAIELKLSESPELGRSPESQM
AEHQALMDEILMLQDEINELQSSLAEELVSESCEADPAEQLALQSTLTVLAERMSTIRMK
ASGKRQLLEEKLNDQLEEQRQEQALQRYRCEADELDSWLLSTKATLDIALGTPKEPMDME
AQLVDCQNMLVEIEQKVVALSELSVHNENLMLEGKAHTKDEAEQLAGKLRRLKGSLLELQ
RALHDKQLNMQGTAQEKEESDVDLTATQSPGVQEWLAQARTTRTHQRQSSLQQQKELEQE
LAEQKSLLRSVASRGEEILIQHSAAETSGGAGEKPDALSQELGMEGEKSSTEDQMRMKWE
SLHQEFSTKQKLLQNVLEQEQEQVLYSRPNRLLSGVPLYKGDVPTQDKSAVTSLLDGLNQ
AFEEVSSQSGGTKRQSIHLEQKLYDGVSATSTWLDDVEERLFVATALLPEETETCLFNQE
ILAKDIKEMSEEMDKNKHLFSQAFPENGDNRDVIEDTLGCLLGRLSLLDSVVNQRCHQMK
ERLQQILNFQNDLKVLFTSLADNKYIILQKLANVFEQPVAEQIEAIQQAEDGLKELDAGI
IELKRRGDKLQIEQPSMQELSKLQDMYDELMMTIGSRRSGLNQNLTLKSQYERALQDLAD
LLETGQEKMAGDQKIIVSSKEEIQQLLDKHKEYFQGLESHMILTETLFRKIISFAVQKET
QFHTELMAQASAVLKRAHKRGVELEYILETWSHLDEDQQELSRQLEVVESSIPSVGLVEE
NEDRLIDRITLYQHLKSSLNEYQPKLYQVLDDGKRLLISITCSDLESQLNQLGEHWLSNT
NKVSKELHRLETILKHWTRYQSESADLIHWLQSAKDRLEFWTQQSVTVPQELEMVRDHLN
AFLEFSKEVDAKSSLKSSVLSTGNQLLRLKKVDTATLRSELSHIDSQWTDLLTNIPAVQE
KLHQLQMDKLPSRHAISEVMSWISLMENVIQKDEDNIKNSIGYKAIHEYLQKYKGFKIDI
NCKQLTVDFVNQSVLQISSQDVESKRSDKTDFAEQLGAMNKSWQILQGLVTEKIQLLEGL
LESWSEYENNVQCLKTWFETQEKRLKQQHRIGDQASVQNALKDCQDLEDLIKAKEKEVEK
IEQNGLALIQNKKEDVSGVVMSTLRELGQTWANLDQMVGQLQILLKSVLDQWSNHKAAFD
EINSYLMEARYSLSRFRLLTGSLEAVQVQVDNLQNLQDDLEKQETSLQKFGSITNQLLKE
CQPPVTETLTNTLKEVNMRWNNLLEEIAEQLHSSKALLQLWQRYKDYSKQCSSMVQQQED
RTNELLKAATNKDIADDEVATWIQDCNDLLKGLGTVKDSLFVLHELGEQLKQQVDASAAS
AIQSDQLSLSQHLCALEQALCKQQTALQAGVLDYETFAKSLEALEAWIVEAEEILQGQDP
SHSSDLSTIQERMEELKGQMLKFSSMAPDLDRLNELGYRLPLNDKEIKRMQNLNRHWSLI
SSQTTERFSKLQSFLLQHQTFLEKCETWMEFLVQTEQKLAVEISGNYQHLLEQQRAHELF
QAEMFSRQQILHSIIIDGQRLLEQGQVDDRDEFNLKLTLLSNQWQGVIRRAQQRRGIIDS
QIRQWQRYREMAEKLRKWLVEVSYLPTSGLGSVPIPLQQARTLFDEVQFREKVFLRQQGS
YILTVEAGKQLLLSADSGAEAALQDELTEIQEKWKSASMRLEEQKKKLAFLLKDWEKCEK
GIADSLEKLRTFKKQLSQSLPDHHEELHAEQMRCKELENAVGSWTDDLTQLTLLKDTLSA
YISADDISILNERIELLQRQWEELCHQLSLRRQQISERLNEWAVFSEKNKELCEWLTQME
SKVSQNGDILIEEMIEKLRKDYQEEIAIAQENKIQLQQMGERLAKASHESKASEIEYKLG
KVNDRWQHLLDLIAARVKKLKETLVAVQQLDKNMSILRTWLAHIESELAKPIVYDSCNSE
EIQRKLNEQQELQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNLDRRW
RNICAMSMERRLKIEETWRLWQKFLDDYSRFEDWLKISERTAAFPSSSGVIYTVAKEELK
KFEAFQRQVHECLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRVTSIL
RRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVQAKIKQLKAFQQEISLNH
NKIEQIIAQGEQLIEKSEPLDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLPDDEH
DLSDRELELEDSAALSDLHWQDRSADSVLSPQPSSNPSLSLAQPLRSERSGRDTPASVDS
IPLEWDHDYDLSRDLESAVSRALPSEDEDGQDDKDFYLRGAVGLSGDHSALESQIRQLGR
ALDESRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSGSIDSVKRLEHKLKEEEES
LPGFVNLHSTETQMAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLNSIWAWLGDTE
EELEHLQHLELSTDIHTIELQIKKLKELQKAVDHRKAIILSINLCSPEFTQADSKESQDL
QDRLSQMNGRWDRVCSLLEEWRGLLQDALMQCQGFHEMSHGLLLMLENIDRRKNEIVPID
PNLDAEVLQDHHKQLMQIRRELLESQLRVASLQDMSCQLLVNAEGADCLEAKEKVHVIGN
RLKLLLKEVSRHIKELEKLLDVSSSQQDLSSWSSADELDTSGSVSPTSGRSTPNRQKTPR
GKCSLSQPGPSVSSPHSRSTKGGFDSSLSEPGPARSGRAFLFRVLRAALPLQLLLLLLIG
LACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences F7GSU6
ENSCJAP00000024387 ENSCJAP00000023682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]