SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024432 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024432
Domain Number 1 Region: 58-184
Classification Level Classification E-value
Superfamily Lysozyme-like 1.1e-47
Family C-type lysozyme 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024432   Gene: ENSCJAG00000013306   Transcript: ENSCJAT00000025841
Sequence length 186
Comment pep:novel chromosome:C_jacchus3.2.1:7:27622273:27645190:-1 gene:ENSCJAG00000013306 transcript:ENSCJAT00000025841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPGSWSRASSADSPEKSASGAGTRNLHFQFCLQQALRMKAVGLLTLIGCLVTGAESKIY
TRCKLAKIFSRAGLDNYGGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFTW
CRQGKLQERNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCEGRDLSKWK
KGCEVS
Download sequence
Identical sequences F7EX21
ENSCJAP00000024432 ENSCJAP00000024432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]