SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000024895 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000024895
Domain Number 1 Region: 71-127
Classification Level Classification E-value
Superfamily BPTI-like 9.08e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000024895   Gene: ENSCJAG00000013530   Transcript: ENSCJAT00000026320
Sequence length 196
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:31540718:31574657:1 gene:ENSCJAG00000013530 transcript:ENSCJAT00000026320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQLCGPRRGRALLALLASLLLSGVLAADGERGIHENATGDLAISRNAADSSVPSAPRRQ
DSDDHSSDMFNYEEYCTAKAVTGPCRAAFPRWYFDVERNSCDNFIYGGCRGNKNSYLSEE
ACMLRCFRESGVPQPRPSLVSVVVLAGLLVMVLILFLGASMVYLIRVARRKQEWALRTIW
STGDDEEHLVKNTYVL
Download sequence
Identical sequences F6SYC4
ENSCJAP00000024895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]