SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025062 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025062
Domain Number 1 Region: 85-153
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.35e-29
Family Skp1 dimerisation domain-like 0.0000133
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.23e-25
Family BTB/POZ domain 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025062   Gene: ENSCJAG00000013613   Transcript: ENSCJAT00000026490
Sequence length 160
Comment pep:novel chromosome:C_jacchus3.2.1:2:71139899:71161719:1 gene:ENSCJAG00000013613 transcript:ENSCJAT00000026490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVGGTQFCL
Download sequence
Identical sequences F6YJX0
ENSCJAP00000025062 ENSCJAP00000025062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]