SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025320 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025320
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 5.06e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0059
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000425
Family TGS domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025320   Gene: ENSCJAG00000013752   Transcript: ENSCJAT00000026758
Sequence length 338
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:21:29530381:29551100:-1 gene:ENSCJAG00000013752 transcript:ENSCJAT00000026758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEALAMGVRALGLLRVAPGGGVSRRFIVTSPASQLSPTELTEMRNDLFNKEKARQLSLTP
RTEKIEVKHVGKTDPGTIFMMNKNISTPYNCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIQFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEYMVNLVRAPEVPVISGAFC
YDVVLDSRLDEWIPTKENLRSFTKDAHVLIYKDLPFETLEVDAKVALEIFQHNKYKIDFT
EEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEISAVHSLQPTQPSLIRRFQGL
SLPVHLRAHFTIWDKLLERSRKMVTEDQTKPTEESTST
Download sequence
Identical sequences F7BJ15
ENSCJAP00000025320 XP_002761372.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]