SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025390 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000025390
Domain Number - Region: 119-243
Classification Level Classification E-value
Superfamily Apolipophorin-III 0.0654
Family Apolipophorin-III 0.0025
Further Details:      
 
Domain Number - Region: 270-319
Classification Level Classification E-value
Superfamily Globin-like 0.0758
Family Phycocyanin-like phycobilisome proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025390   Gene: ENSCJAG00000013807   Transcript: ENSCJAT00000026831
Sequence length 454
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01185297.1:274:4456:1 gene:ENSCJAG00000013807 transcript:ENSCJAT00000026831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEKIFKSMGTLLDFKISIFNYRLILQQQEEKRRKPEKYEKGIEKFKIMEEQYWTQARVKN
LLKLTHKSLNIELKTVRNNLNQSSFTHEKERDLWQKNHLMRVEIARLRLEIDTIKHQNQE
IENMYFKDIEIIKKKNEDLEKTLKLNEETLTKTINWYSEELNGLTLDKNTVLNSELEKEK
QRKQRLETELELYSRRLAAALCDRDQSQSSKRDLQLAFQNTVNQWCHLQENMNSHIQILS
QQLSKAESKSRGLETELHCEREALKEKTLAIEHMQGVISQAQCRMKAFEHMYQNDQHIVE
KYVRKQQSVQDGLFQIQSQNSLHQQQLNDAHKKADNQEKTIIDIQAKCEDTVEKLQAECR
KHCILLEENNKGLIEEYTLLKERQCQYEKEKEEGQVVVRKLKRELGDVLNKQSLAEGMLE
ISSQRQNMLEDTKKKLELMRSQVCMKLSLSTVTL
Download sequence
Identical sequences H9KX17
ENSCJAP00000025390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]