SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025412 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025412
Domain Number 1 Region: 150-271
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 2 Region: 37-145
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 3 Region: 379-506
Classification Level Classification E-value
Superfamily EF-hand 2.37e-23
Family EF-hand modules in multidomain proteins 0.082
Further Details:      
 
Domain Number 4 Region: 274-386
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-22
Family Spectrin repeat 0.00000238
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000025412
Domain Number - Region: 1-36
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00059
Family Spectrin repeat 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025412   Gene: ENSCJAG00000015020   Transcript: ENSCJAT00000026859
Sequence length 534
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:94097814:94211043:-1 gene:ENSCJAG00000015020 transcript:ENSCJAT00000026859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGK
EAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVN
ARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQ
DTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYT
TITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEI
GRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHI
RVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRA
CLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAG
DKNYITVEELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences F6WKH9
ENSCJAP00000025412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]