SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025413 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025413
Domain Number 1 Region: 8-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-85
Family Calponin-homology domain, CH-domain 0.0000141
Further Details:      
 
Domain Number 2 Region: 255-377
Classification Level Classification E-value
Superfamily Spectrin repeat 4.11e-35
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 491-609
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.0000058
Further Details:      
 
Domain Number 4 Region: 378-486
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-25
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 5 Region: 615-727
Classification Level Classification E-value
Superfamily Spectrin repeat 1.73e-23
Family Spectrin repeat 0.00000287
Further Details:      
 
Domain Number 6 Region: 720-852
Classification Level Classification E-value
Superfamily EF-hand 7.99e-23
Family EF-hand modules in multidomain proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025413   Gene: ENSCJAG00000013777   Transcript: ENSCJAT00000026860
Sequence length 880
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:31956903:32040585:1 gene:ENSCJAG00000013777 transcript:ENSCJAT00000026860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVI
SGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIIL
RFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIE
YDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGA
QKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQK
LEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLE
QAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKA
LIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHS
RREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHD
QFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGSNPYTTVTPQIINSKWEKVQQLVP
KRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLK
QYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVE
NQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGDAEF
NRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTAEQVIASFKVLAGDKNFITAEELRREL
PPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL
Download sequence
Identical sequences F6WKH1
ENSCJAP00000025413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]