SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025493 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025493
Domain Number 1 Region: 57-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000144
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025493   Gene: ENSCJAG00000013872   Transcript: ENSCJAT00000026942
Sequence length 103
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:120418870:120425512:-1 gene:ENSCJAG00000013872 transcript:ENSCJAT00000026942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGVPISVYLLFNAMTALTEDAAVTVTPPITAQQGNWTVNKTEADNIEGPIVLKLSHSC
LKDHNSYCINGACAFHHELEKAICRCLKLKSPYNVCSGGRQPL
Download sequence
Identical sequences F7BHK9
ENSCJAP00000025493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]