SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025555 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025555
Domain Number 1 Region: 485-782
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.96e-84
Family Pancreatic carboxypeptidases 0.0000000017
Further Details:      
 
Domain Number 2 Region: 55-369
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.95e-73
Family Pancreatic carboxypeptidases 0.000000933
Further Details:      
 
Domain Number 3 Region: 911-1198
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.06e-67
Family Pancreatic carboxypeptidases 0.0000127
Further Details:      
 
Domain Number 4 Region: 782-862
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.94e-19
Family Carboxypeptidase regulatory domain 0.0000311
Further Details:      
 
Domain Number 5 Region: 370-456
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 4.32e-17
Family Carboxypeptidase regulatory domain 0.00082
Further Details:      
 
Domain Number 6 Region: 1199-1297
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000000235
Family Carboxypeptidase regulatory domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025555   Gene: ENSCJAG00000013845   Transcript: ENSCJAT00000027010
Sequence length 1365
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:93599445:93678121:-1 gene:ENSCJAG00000013845 transcript:ENSCJAT00000027010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGRDARLPWQLGRLPLLLCLLLLKSSARAAHIKKAEATTTTNAGAEAAEGQFDRYYHE
EELGSALRLFSIGRSVEGRPLWVLRLTAGLGSLIPESDAGPDPAGPDAAGPLVPGRPQVK
LVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLPSLNPDGFERAREG
DCGLDDGGPPGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRALIEWIRRNKFVLS
GNLHGGSVVASYPFDDSPEHKATGFYSKTSDDEVFKYLAKAYASNHPIMKTGEPHCPGDE
DESFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWENNRESL
ITLIEKVHIGVKGFVKDSVTGSGLENATISVAGINHNITTGRFGDFHRLLVPGTYNLTVV
LTGYMPLTVTNIVVKEGPATEVDFSLRPSVTSVIPDTTEAIATASTVAIPNIPSGTLSSY
QPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEISDNPGVHEPG
EPEFKYIGNMHGNEVVGKELLLNLIEYLCKNFGTDPEVTDLVRSTRIHLMPSMNPDGYEK
SQEGDSISVIGRNNSNNFDLNRNFPDQFVHITDPTQPETIAVMSWMKSYPFVLSANLHGG
SLVVNYPFDDDERGVATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKNMYPNEYFPHGI
TNGANWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPFEKELPNFWEQNRRSLIQFMKQVH
QGVKGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITASARGYNPVT
KNVTVKSEGATQVNFTLVRSSTDSNNESKKGKGASTSTDDASDPTTKEFETLIKDLSAEN
GLESLMLPSSSNLALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSAEYRHIWSLEISN
KPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLVDRTRIVIVPL
LNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAIIENLIQKQDFSLSVAL
DGGSVLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSCPNKSDENIPGGVMRG
AEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAAQLPSLWADNKRSLLSMLVEVHKGV
HGFVKDKTGKPVSKAVIVLNEGIKVHIKEGGYFHVLLAPGVHNINAIADGYQQQHSQVFV
HHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIWCICSIKSNRHKDGFH
RLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences F6XTA7
ENSCJAP00000025555 ENSCJAP00000025555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]