SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025780 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025780
Domain Number 1 Region: 43-95
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000969
Family CUE domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025780   Gene: ENSCJAG00000014010   Transcript: ENSCJAT00000027240
Sequence length 386
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:99482411:99523814:1 gene:ENSCJAG00000014010 transcript:ENSCJAT00000027240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSLFRRSSSGSGGGGTAGARGGGGGGGAAAPQELNNSRPARQVRRLEFNQAMDDFKTMF
PNMDYDIIECVLRANSGAVDATIDQLLQMNLEGGGSGVYEDSSDSEDSIPPEILERTLEP
DSSDEEPPPVYSPPAYHMHMFDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGN
LPDDFLRILPQQLDSIQGNAGGPKPGSGEGGLPAMAGSGPRDQESRWKQYLEDERIALFL
QNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVSVGNDFGFPSPVPGTGDANPAVSE
DALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLRHHSLGAAASTANLLDDVE
GHACDEDFRGRQREAPKVEEGLREGQ
Download sequence
Identical sequences F6URI2
XP_002748438.1.60252 ENSCJAP00000025774 ENSCJAP00000025780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]