SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025873 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025873
Domain Number 1 Region: 298-412
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-34
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 142-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 3 Region: 463-570
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.55e-24
Family Frizzled cysteine-rich domain 0.0005
Further Details:      
 
Domain Number 4 Region: 256-292
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 417-451
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000119
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025873   Gene: ENSCJAG00000014068   Transcript: ENSCJAT00000027339
Sequence length 578
Comment pep:novel chromosome:C_jacchus3.2.1:11:16997376:17003577:-1 gene:ENSCJAG00000014068 transcript:ENSCJAT00000027339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSDVILCVEATESSKTEFCNPAFEPESGPPCPLPAFPEDASYSIPAPWHGRLPRGLQ
PDCRFSWLCMLLLASLLLLLLGLLVAIILAQLQAAPPSGTSHSPLPAGGLTTTIPTITNS
QAAGTPKGQQEAGVSPSPQSTCGGLLSGPRGFFSSPNYPDPYPPNAHCVWHIQVATDHTI
QLKIEALSIESVASCLFDRLEISPDPEGPLLRVCGRVPPPTLNTNASHLLVAFVSDSSVE
GFGFHAWYQAVAPGHGSCAHDEFHCDQLICLLPDSVCDGFANCADGSDETNCSAKFSGCG
GNLTGLQGTFSTPSYLQQYPHQQLCTWHISVPAGHGIELQFHNFSLEAQDECKFDYVEVY
ETSSSGAFSLLGRFCGAEPPPLLVSSHHELAVLLRTDHGISSGGFSATYLAFNTTENRCG
PSELSCQAGGCKGVQWMCDMWRDCTDGSDDNCSSPLFPPPELACEPVQVEMCLGLSYNTT
AFPNIWVGMATQEEVVEVLSGYKSLTSLPCYQNFRRLLCGLLVPRCTPLGSVLPPCRSVC
QEAEHQCQSSGLAGRGTNPGWPTDCQRTPASGLPVPAP
Download sequence
Identical sequences F6ZDA5
ENSCJAP00000025873 ENSCJAP00000025873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]