SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000025944 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000025944
Domain Number 1 Region: 110-229
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 9.55e-44
Family Frizzled cysteine-rich domain 0.000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000025944   Gene: ENSCJAG00000014119   Transcript: ENSCJAT00000027417
Sequence length 591
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:32412718:32417828:-1 gene:ENSCJAG00000014119 transcript:ENSCJAT00000027417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRGLAGLETRRGGARCTKPRPCPLWLTLLRVSIPQTRSEPCRPRGASGAEAGKLGEGRCS
RRGGGGGGGGWARAAPLRCPIRLPEVASLLAALALLQRSSGAAAASAKELTCQEITVPLC
KGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKP
LPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCERLPEQGNPDTLCMDYNRTDLTEPGCQC
RAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFP
TVSTFLIDMERFKYPERPIIFLSACYLFLSVGYLVRLVAGHEYEELGAVEHHVRYKTTGP
ALCSVVFLLVYFLVMASSIWWVILSLTWFLEAGMKWGNETIAGYSQYFHLATWLVPNISI
AVLALNSVDGDPVAGICYLVNHSLYNLRGLVLAPLVIYLFMYIKILLTIFALLLSIFFFF
KHQVVPTIKHNRIKGLKQVIYTNKKEEVVEYIFIEQHNRPRWEATHNCPCLRDLQPDQAR
RPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRSLCTRCCWARHGENYL
Download sequence
Identical sequences F6VWI5
ENSCJAP00000025944 ENSCJAP00000025944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]