SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026705 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026705
Domain Number 1 Region: 240-487
Classification Level Classification E-value
Superfamily Folate-binding domain 2.04e-54
Family Aminomethyltransferase folate-binding domain 0.00059
Further Details:      
 
Domain Number 2 Region: 45-147
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-19
Family L-aminoacid/polyamine oxidase 0.046
Further Details:      
 
Domain Number 3 Region: 4-43,148-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000233
Family FAD-linked reductases, N-terminal domain 0.015
Further Details:      
 
Domain Number 4 Region: 490-582
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000000018
Family Aminomethyltransferase beta-barrel domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026705   Gene: ENSCJAG00000014501   Transcript: ENSCJAT00000028227
Sequence length 638
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:20:28200642:28244450:-1 gene:ENSCJAG00000014501 transcript:ENSCJAT00000028227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKGQVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPISIPLHACEHFYLLTRPLET
PLQSSTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPL
LSSLLRRMPELESLEIMKLVNCPETFTPDMRCIMGESPAVQGYFVLAGMNSAGLSFGGGA
GKYLAEWMVHGYPSENVWELDLKRFGALQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGR
QLRTSPLYDRLDAQGARWMEKHGFERPKYFVPPDKDLLALEQSKTFYKPDWFDIVESEVK
CCKEAVCVIDMSSFTKFEITSTGDQALEVLQYLFSNDLDVPVGHIVHTGMLNEVGGYEND
CSIARLSKRSFFMISPTDQQVHCWAWLKKHMPKDSNLLLEDVTWKYTALNLIGPRAVDVL
SELSYAPMTPDHFPSLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEGMDFIGRDALL
QQKQNGVYKRFTMFILDDHDTDLDLWPWWGEPIYRNGQYVGKTTSSAYSYSLERHVCLGF
VHNFSEDTGEEQVVTADFINRGEYEIDIAGYRFQAKAKLYPVASLFTHKRRKDDMELSDL
PSLDLLFPPPNIHSGLFFPPAFSFSWWQDVCLTGRTEA
Download sequence
Identical sequences F7INB4
ENSCJAP00000026705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]