SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026786 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026786
Domain Number 1 Region: 8-76
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000288
Family GAF domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026786   Gene: ENSCJAG00000014554   Transcript: ENSCJAT00000028312
Sequence length 98
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:40641923:40677043:1 gene:ENSCJAG00000014554 transcript:ENSCJAT00000028312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTL
LKCERCSVLLLEDIESPLSGFVKPFGFQGEICWVDKQH
Download sequence
Identical sequences F7IDU5
ENSCJAP00000026786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]