SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026798 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026798
Domain Number 1 Region: 29-126,240-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000171
Further Details:      
 
Domain Number 2 Region: 375-503
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.92e-29
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026798   Gene: ENSCJAG00000014546   Transcript: ENSCJAT00000028324
Sequence length 505
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:184305731:184360329:-1 gene:ENSCJAG00000014546 transcript:ENSCJAT00000028324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGPAGCVPQTCAGCISSHLSSLPSAGQWDYDLLVIGGGSGGLACAKEAAQLGRKVAVVDY
VEPSPRGTRWGLGGTCVNVGCIPKKLMHQAALLGGLIRDAPHYGWEVAQPVPHDWRKMAE
AVQNHVKSLNWGHRVQLHDRPIGSINCEIHFLDPHILFSWPLRGRSPWVSPPAWPPLFRQ
IEGALEYGITSDDIFWLKESPGKTLFSGAADVALECAGFLTGIGLDVTVMMRSIPLRGFD
QQMSSLVTEHMASHGTRFLRGCTPSQVRRLLDGQLQVTWEDHTTGKEGTGTFNTVLWAVG
RVPDTRSLNLEKAGVDTSPNTQKILVDSREATSVPHIYAIGDVVEGRPELTPTAVMAGRL
LAQRLFGGSSDLMDYDKVPTTVFTPLEYGCVGLSEEEAVARHGQEHVEVYHAHYKPLEFT
VPGRDASQCYVKMVCLREPPQPVLGLHFLGPNAGEVTQGFALGIKCGASYVQVMQTVGIH
PTCSEEVVKLRISKRSGLDPTVTGC
Download sequence
Identical sequences F7IDS8
ENSCJAP00000026798 ENSCJAP00000026798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]