SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026846 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026846
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.69e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000044
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 3.27e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000174
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.19e-39
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 521-593
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000101
Family AlaX-M N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026846   Gene: ENSCJAG00000014562   Transcript: ENSCJAT00000028376
Sequence length 968
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:20:28106587:28140560:1 gene:ENSCJAG00000014562 transcript:ENSCJAT00000028376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSTLTASEIRQRFIEFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPIERLYVTYFGGDEAAGLEPDLECKQIWQNLGLEDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDGILKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYAHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKILSLGDSKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLLVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRAQGLEV
TDDSPKYNYHSDSSGNYVFENTVATVLALRREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDEGYLVKVDDSNEDKTEFTVKNAQVRGGYVLHIGTIYGDLKVGDQVRLFIDEPRRRP
VMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMI
EAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSVGVPVSELLDDPSGPAGSLTSV
EFCGGTHLQNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKTSLSLMEAK
VKAQTAPNKDVQREIADLGEVLATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKR
VLEKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKMHSPQTSAMLFTVDNEAGKIT
CLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQ
LHLGDVKN
Download sequence
Identical sequences F7I4E1
XP_002761188.1.60252 XP_008984446.1.60252 ENSCJAP00000026846 ENSCJAP00000026846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]