SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026934 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026934
Domain Number 1 Region: 255-352
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.35e-23
Family Starch-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026934   Gene: ENSCJAG00000014639   Transcript: ENSCJAT00000028473
Sequence length 355
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:118353657:118357446:-1 gene:ENSCJAG00000014639 transcript:ENSCJAT00000028473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVWSALLVGGGLAGALFVWLLRGGSGDTGKDGDAEQEKDAPLGGAAAPGGDQSGSSGL
SPGPSRQELVTKSEHLQESNGHLISKTKDLGSLQAAACRLQNPSREVCDNSREHVPSGQF
PDTDAPATSETGNSRSHSEVSRNESLESPMREWGFQKGRETSAKAATCFAEKLPSSNLLT
NRAKEEMSLSHLNSQDRVDHEEWEMVSRHSSWGDVGSLEAPVLSPKQGMDNGRSTLVEAR
GWQLHGKTEKVAVMPAGSQQVSVRFQVHYITSTDVQFIAITGDHECLGRWNTYIPLSYSK
DGFWSHSIFLPADTVVEWKFVLVENGGVTRWEECSNRFLETGHEDKVVHAWWGIH
Download sequence
Identical sequences F7HPD9
ENSCJAP00000026934 ENSCJAP00000026934 XP_002745737.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]