SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026949 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026949
Domain Number 1 Region: 106-203
Classification Level Classification E-value
Superfamily Starch-binding domain-like 4.17e-24
Family Starch-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026949   Gene: ENSCJAG00000014639   Transcript: ENSCJAT00000028489
Sequence length 206
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:118354450:118422755:-1 gene:ENSCJAG00000014639 transcript:ENSCJAT00000028489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREWGFQKGRETSAKAATCFAEKLPSSNLLTNRAKEEMSLSHLNSQDRVDHEEWEMVSRH
SSWGDVGSLEAPVLSPKQGMDNGRSTLVEARGWQLHGKTEKVAVMPAGSQQVSVRFQVHY
ITSTDVQFIAITGDHECLGRWNTYIPLSYSKDGFWSHSIFLPADTVVEWKFVLVENGGVT
RWEECSNRFLETGHEDKVVHAWWGIH
Download sequence
Identical sequences F7ISV4
ENSCJAP00000026949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]