SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000026987 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000026987
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.28e-23
Family Protein-L-isoaspartyl O-methyltransferase 0.046
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000026987
Domain Number - Region: 207-224
Classification Level Classification E-value
Superfamily SOCS box-like 0.0327
Family SOCS box-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000026987   Gene: ENSCJAG00000014657   Transcript: ENSCJAT00000028529
Sequence length 227
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:4714203:4726664:-1 gene:ENSCJAG00000014657 transcript:ENSCJAT00000028529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYLFQCRFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKILLKVGGILVMP
IEDQLTQIMRTGQNTWESKNILAVSFAPLVQPSKNDNGKADSVGLPPCAVRNLQDLARIY
IRRTLRNFINDEMQAKGLPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPLDSEEDEKMEE
DNKEEEEKDLSEASKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK
Download sequence
Identical sequences F7IN19
ENSCJAP00000026987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]