SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027015 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027015
Domain Number 1 Region: 12-392
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000751
Further Details:      
 
Domain Number 2 Region: 369-494
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.15e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027015   Gene: ENSCJAG00000014635   Transcript: ENSCJAT00000028560
Sequence length 499
Comment pep:known chromosome:C_jacchus3.2.1:9:94290161:94356055:1 gene:ENSCJAG00000014635 transcript:ENSCJAT00000028560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPEDLPESCDYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGT
CVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRV
ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCI
SSDDLFSLPYCPGKTLIVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGE
HMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNNEEIIEGEYNTVLLAIGRDACTR
KIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKVELTPVAIQAGRLLAQRLY
AGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDN
NKCYAKIICNTKDSERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEV
FTTLSVTKRSGASILQAGC
Download sequence
Identical sequences F7G731
ENSCJAP00000027015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]