SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027020 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027020
Domain Number 1 Region: 16-300
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.21e-34
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000327
Further Details:      
 
Domain Number 2 Region: 329-454
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 9.79e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027020   Gene: ENSCJAG00000014635   Transcript: ENSCJAT00000028565
Sequence length 459
Comment pep:novel chromosome:C_jacchus3.2.1:9:94290134:94354666:1 gene:ENSCJAG00000014635 transcript:ENSCJAT00000028565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDW
DRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFL
IATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLIVGASYVALECAGFLAGIGLDVTV
MVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNNEE
IIEGEYNTVLLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEG
KVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEEN
IEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDSERVVGFHVLGPNAGEVTQGFAAALKC
GLTKKQLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC
Download sequence
Identical sequences F7G6Q5
ENSCJAP00000027020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]