SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027191 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027191
Domain Number 1 Region: 360-441
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 124-201
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 3 Region: 205-287
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 4 Region: 13-113
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000043
Family Canonical RBD 0.019
Further Details:      
 
Domain Number 5 Region: 444-525
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027191   Gene: ENSCJAG00000014731   Transcript: ENSCJAT00000028745
Sequence length 539
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:7258640:7438679:-1 gene:ENSCJAG00000014731 transcript:ENSCJAT00000028745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVDYSVSKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYA
TREEAKIAMEKLSGHQFENYSFKISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGSSQ
ARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATP
EGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKIEHETGTKI
TISSLQDLSIYNPERTITVKGTVEACACAEIEIMKKLREAFENDMLAVNQQANLIPGLNL
SALGIFSTGLSVLSPPAGPRGAPPAAPYHPFAAQTHSGYFSSLYPHHQFGPFPHHHSSCP
PKYPEQEIVNLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGP
PEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTTVNELQNLTS
AEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKHQEQKYPQGVASQRSK
Download sequence
Identical sequences F7H059
ENSCJAP00000027191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]