SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027329 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027329
Domain Number 1 Region: 13-94
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.05e-19
Family Interleukin 8-like chemokines 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027329   Gene: ENSCJAG00000014839   Transcript: ENSCJAT00000028891
Sequence length 107
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:116975025:117042171:-1 gene:ENSCJAG00000014839 transcript:ENSCJAT00000028891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFILASLLLMLLISSLSPVQGILEVHNTNLRCKCVQETSAFIPLTLIDRIQILPRGHGC
PRKEIIIWKKNKSVVCLNPRAEWIQKIMKNLKKKRIPTLPLPVFKIP
Download sequence
Identical sequences F7DV54
ENSCJAP00000027329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]