SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027822 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027822
Domain Number 1 Region: 29-151
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-34
Family Spectrin repeat 0.000000652
Further Details:      
 
Domain Number 2 Region: 265-386
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 3 Region: 152-260
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 4 Region: 389-501
Classification Level Classification E-value
Superfamily Spectrin repeat 2.59e-22
Family Spectrin repeat 0.00000238
Further Details:      
 
Domain Number 5 Region: 494-597
Classification Level Classification E-value
Superfamily EF-hand 8.32e-19
Family Calmodulin-like 0.0066
Further Details:      
 
Domain Number 6 Region: 634-685
Classification Level Classification E-value
Superfamily EF-hand 0.00000000272
Family EF-hand modules in multidomain proteins 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027822   Gene: ENSCJAG00000015020   Transcript: ENSCJAT00000029401
Sequence length 686
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:94098220:94211151:-1 gene:ENSCJAG00000015020 transcript:ENSCJAT00000029401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLE
NRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEG
RMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLR
QKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQK
ICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIV
HTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQ
EINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISI
EMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWE
QLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISM
GYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKFLE
GGKMQLAHAAFTPPGFPAVSLCHFAATLTTLSPQNYITVEELRRELPPDQAEYCIARMAP
YTGPDSVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences F7GNT8
ENSCJAP00000027822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]