SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027825 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027825
Domain Number 1 Region: 3-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-67
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 202-324
Classification Level Classification E-value
Superfamily Spectrin repeat 8.63e-34
Family Spectrin repeat 0.000000652
Further Details:      
 
Domain Number 3 Region: 438-559
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 325-433
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 667-794
Classification Level Classification E-value
Superfamily EF-hand 5.86e-23
Family EF-hand modules in multidomain proteins 0.082
Further Details:      
 
Domain Number 6 Region: 562-674
Classification Level Classification E-value
Superfamily Spectrin repeat 3.31e-22
Family Spectrin repeat 0.00000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027825   Gene: ENSCJAG00000015020   Transcript: ENSCJAT00000029404
Sequence length 822
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:94098144:94209106:-1 gene:ENSCJAG00000015020 transcript:ENSCJAT00000029404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLG
MIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHR
HRPELFDYGSWRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSF
YHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENT
MHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDIN
NAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETA
TLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDN
LGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQ
GLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWD
HVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLE
DQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIA
RTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNMGEA
EFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITVEELRR
ELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences F7GNT1
ENSCJAP00000027825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]