SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027842 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027842
Domain Number 1 Region: 7-240
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-81
Family Calponin-homology domain, CH-domain 0.0000327
Further Details:      
 
Domain Number 2 Region: 258-380
Classification Level Classification E-value
Superfamily Spectrin repeat 1.04e-33
Family Spectrin repeat 0.000000652
Further Details:      
 
Domain Number 3 Region: 494-615
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-31
Family Spectrin repeat 0.00000366
Further Details:      
 
Domain Number 4 Region: 381-489
Classification Level Classification E-value
Superfamily Spectrin repeat 5.89e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 618-730
Classification Level Classification E-value
Superfamily Spectrin repeat 3.89e-22
Family Spectrin repeat 0.00000238
Further Details:      
 
Domain Number 6 Region: 729-831
Classification Level Classification E-value
Superfamily EF-hand 5.32e-19
Family EF-hand modules in multidomain proteins 0.0051
Further Details:      
 
Domain Number 7 Region: 834-904
Classification Level Classification E-value
Superfamily EF-hand 1.95e-18
Family EF-hand modules in multidomain proteins 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027842   Gene: ENSCJAG00000015020   Transcript: ENSCJAT00000029421
Sequence length 905
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:94097496:94211151:-1 gene:ENSCJAG00000015020 transcript:ENSCJAT00000029421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVI
SGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIIL
RFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHIRASWKDGLGFCALIHRHRPEA
GFDYGSWRSDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAF
SGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAM
QQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWG
CLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSE
IKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGAL
TQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTT
AHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQ
LVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLS
HLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTIN
EVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQKK
TGMMDTDDFRACLISMGYNMGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTAD
QVMASFKILAGDKNYITVEELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALY
GESDL
Download sequence
Identical sequences F7GFZ5
ENSCJAP00000027842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]