SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000027860 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000027860
Domain Number 1 Region: 534-884
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.12e-88
Family PDEase 0.00000818
Further Details:      
 
Domain Number 2 Region: 347-529
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-49
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 178-360
Classification Level Classification E-value
Superfamily GAF domain-like 1.83e-33
Family GAF domain 0.0000000198
Further Details:      
 
Domain Number 4 Region: 2-150
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000785
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000027860   Gene: ENSCJAG00000015101   Transcript: ENSCJAT00000029440
Sequence length 896
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:66213880:66246016:1 gene:ENSCJAG00000015101 transcript:ENSCJAT00000029440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDALLSLGSVIDVSGLQRAVKEALSAVLPRVETVYTYLLDGESRLVCEDPPHELPQEGKV
REAVISRKRLDCNGLGLSDLPGKALARLVAPLAPDTQVLVIPLADKEAGAVAAVILVHCG
QLSDSEEWSLQAVERHTLVALRRVQALQQRGPSEAPRAIQNPPEGAAEDQKDGAAYTDRD
RKILQLCGELYDLDASSLQLKVLQYLQQETRASRCCLLLVSEDNLQLSCKVIGDKVLGEE
VSFPLTGCLGQVVEDKKSIQLKDLTSEDVQQLQSMLGCELQAVLCVPVISRATDQVVALA
CAFNKLEGDLFTDHDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHL
DDVSVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAG
HVATTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGP
WFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLH
DGIQPVAAIDSNFASFTYTPRSLPEDDTSLDAILSMLQDMNFINNYKIDCPTLARFCLMV
KKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNS
FQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIIL
ATDLAHHLRIFKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELI
YKEFFSQGDLVCVESPQDVQVGGGFLAWGWEAWVADLVPVVLPLYTHRLLQDLFPKAAEL
YERVASNREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTRAPINGCCIDAE
Download sequence
Identical sequences F7G3T8
ENSCJAP00000027860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]