SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Callithrix jacchus 76_3.2.1 > ENSCJAP00000027874

Domain assignment for ENSCJAP00000027874 from Callithrix jacchus 76_3.2.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCJAP00000027874
Domain Number 1	Region: 111-146
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000000144
Family	CCCH zinc finger	0.00033
Further Details:

Domain Number 2	Region: 151-183
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000000183
Family	CCCH zinc finger	0.00024
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCJAP00000027874 Gene: ENSCJAG00000015116 Transcript: ENSCJAT00000029454
Sequence length	338
Comment	pep:known_by_projection chromosome:C_jacchus3.2.1:10:94001622:94007662:-1 gene:ENSCJAG00000015116 transcript:ENSCJAT00000029454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSS KFHQNQLLSSLKSEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGSGQVNSSRYKTELC RPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAE ERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGS PTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLS DQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD
Download sequence
Identical sequences	F7FRV2 ENSCJAP00000027865 ENSCJAP00000027874 XP_009004482.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]