SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028148 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028148
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000000183
Family Kelch motif 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028148   Gene: ENSCJAG00000015290   Transcript: ENSCJAT00000029747
Sequence length 234
Comment pep:novel chromosome:C_jacchus3.2.1:14:14827259:14828367:-1 gene:ENSCJAG00000015290 transcript:ENSCJAT00000029747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAWKRQLILFGGFHESTWDYIYCNDGYAFNLDTFTWSELSPAGRSGCQIFVTPQGSIVL
YRGYLKQRVKKDVDKGTRHSDMFLLKPEGGREDKWVWTRINRSGVKPTPRSGFSVAMAPN
HQTLFSRGVCDEEEEENLEGEVFNYLYSYEATRNRWFAGQLKKLKSGSRRRTRKRTVRRR
SRAPRVDMRTRTVQRRAARRTESPCRGLESAVPPSTQDPAVLGDAVSSPSPDEQ
Download sequence
Identical sequences F7A7Z8
ENSCJAP00000028148 ENSCJAP00000028148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]