SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028254 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028254
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.5e-25
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 42-73,123-181
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-23
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028254   Gene: ENSCJAG00000015327   Transcript: ENSCJAT00000029859
Sequence length 411
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:9528587:9682127:-1 gene:ENSCJAG00000015327 transcript:ENSCJAT00000029859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPDLLDPKSAAQNSKPRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVLYLII
GATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNT
SNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQ
LGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIEGWSALD
AIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYFAAVLSMIGDWLRVIS
KKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATSIKRKLSAELAGNHNQ
ELTPCRRTLSVNHLTSERDVLPPLLKTESIYLNGLTPHCAGEEIAVIENIK
Download sequence
Identical sequences A0A0D9RSQ6 A0A2J8QV69 A0A2K5KVN0 F6VQD0 U3N6F0
ENSCJAP00000028254 NP_055032.1.87134 NP_055032.1.92137 XP_001171649.1.37143 XP_002760564.1.60252 XP_003265159.1.23891 XP_003814201.1.60992 XP_005540900.1.63531 XP_007986642.1.81039 XP_010355070.1.97406 XP_011759526.1.29376 XP_011784808.1.43180 XP_011851554.1.47321 XP_011896099.1.92194 XP_012315075.1.9421 XP_012637209.1.48125 XP_014971786.1.72884 XP_017364709.1.71028 XP_017725428.1.44346 ENSP00000375764 ENSP00000375764 gi|14589851|ref|NP_055032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]