SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028476 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000028476
Domain Number - Region: 261-287
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0314
Family Frizzled cysteine-rich domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028476   Gene: ENSCJAG00000015439   Transcript: ENSCJAT00000030091
Sequence length 587
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:11718614:11726187:1 gene:ENSCJAG00000015439 transcript:ENSCJAT00000030091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALQSLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGTRGYSLNLIPPALISGEHLR
VCPQEYTCCSSETEQRLIRESENTFRGLVADSGSFLWPHPLSTCFPAFAAEFFLEMLSVA
QHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLL
HPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRIVV
SEALKPPFLQFCARALMRLIGCPLCRGVPSMPCRGFCLNVVRGCLSNRGLEPDWGNYLDG
LLILADKLQGPFSFELAAESIGVKISEGLMYLQENSVKVSTQVFQECGPPNPVPARNRRA
PPPREEASRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDSRMA
ADASLEAAPCWTGQRELWGCSARRYLPPVIGGTAAEQVNNPELKVDTSGPDVPTRRRRLQ
LRAATARMKAAALGHDLDGQDTADEDASGSGGGQQYADDWMAGAGAPPVRPPRPPYPPRR
DGSGGKGGGGSARYNQGRSRSGGASIGFPTQTILILSLSALTLLGPR
Download sequence
Identical sequences F6V2S8
ENSCJAP00000028490 ENSCJAP00000028476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]