SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028490 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000028490
Domain Number - Region: 250-288
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00602
Family Frizzled cysteine-rich domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028490   Gene: ENSCJAG00000015439   Transcript: ENSCJAT00000030105
Sequence length 581
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:11718446:11726819:1 gene:ENSCJAG00000015439 transcript:ENSCJAT00000030105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALQSLLLLLLPLCPGPGPGPGSEAKVTRSCAETRQVLGTRGYSLNLIPPALISGEHLR
VCPQEYTCCSSETEQRLIRESENTFRGLVADSGSFLWPHPLSTCFPAFAAEFFLEMLSVA
QHSLTQLFSHSYGRLYAQHALIFNGLFSRLRDFYGESGEGLDDTLADFWAQLLERVFPLL
HPQYSFPPDYLLCLSRLASSTDGSLQPFGDSPRRLRLQITRTLVAARAFVQGLETGRIVV
SEALKVPVSEGCSQALMRLIGCPLCRGVPSLMPCRGFCLNVVRGCLSNRGLEPDWGNYLD
GLLILADKLQGPFSFELAAESIGVKISEGLMYLQENSVKVSTQVFQECGPPNPVPARNRR
APPPREEASRLWSMVTEEERPTTAAGTNLHRLVWELRERLARMRGFWARLSLTVCGDSRM
AADASLEAAPCWTGAGRGRYLPPVIGGTAAEQVNNPELKVDTSGPDVPTRRRRLQLRAAT
ARMKAAALGHDLDGQDTDEDASGSGGGQQYADDWMAGAGAPPVRPPRPPYPPRRDGSGGK
GGGGSARYNQGRSRSGGASIGFPTQTILILSLSALTLLGPR
Download sequence
Identical sequences F6UGS3
ENSCJAP00000028490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]