SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028670 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028670
Domain Number 1 Region: 482-836
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.14e-113
Family PDEase 0.000000251
Further Details:      
 
Domain Number 2 Region: 55-253
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-31
Family GAF domain 0.0006
Further Details:      
 
Domain Number 3 Region: 238-291,323-460
Classification Level Classification E-value
Superfamily GAF domain-like 1.09e-30
Family GAF domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028670   Gene: ENSCJAG00000015570   Transcript: ENSCJAT00000030296
Sequence length 858
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:80464288:80525718:1 gene:ENSCJAG00000015570 transcript:ENSCJAT00000030296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDINQDAVEKYLEENPQFAKEYFDKKLRVEVLGEIFKNSQVPVQSSMSFPELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRARNGTPEVASRLLDVTPT
SKFEDNLVGPEKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDKQTGYVTKNLL
ATPIVMGKEVLAVIVALNKVNASEFSKQDEEVFSKYLNFVSVILKLHHTTYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMNKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNHTKATPEEIKSILKFQEKLNVD
VIDECEEKQLVAILKEDLPDPRSVELYEFRFSDFPITEHGLIKCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVLEEEAKKQEEGAEKA
AEDAGGGDDKKSKTCLML
Download sequence
Identical sequences F6V1P7
ENSCJAP00000028670 ENSCJAP00000028670 XP_002756688.3.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]