SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000028737 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000028737
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 2.23e-48
Family C-type lysozyme 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000028737   Gene: ENSCJAG00000015593   Transcript: ENSCJAT00000030366
Sequence length 159
Comment pep:novel chromosome:C_jacchus3.2.1:X:46944183:46949397:1 gene:ENSCJAG00000015593 transcript:ENSCJAT00000030366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAWGTVVVTLAILMVVTVDAKIYERCELAARLERAGLNGYKGYSVGDWLCMAHHESGFD
TTFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIMCAKKIVS
SQNGLSAWTSWRRHCSGHDLSQWLKGCAMQVKTDPKNYP
Download sequence
Identical sequences F7ALE5
ENSCJAP00000028737 XP_002762877.1.60252 ENSCJAP00000028737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]