SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Callithrix jacchus 76_3.2.1 > ENSCJAP00000029160

Domain assignment for ENSCJAP00000029160 from Callithrix jacchus 76_3.2.1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCJAP00000029160
Domain Number 1	Region: 63-87
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000000157
Family	CCCH zinc finger	0.0045
Further Details:

Domain Number 2	Region: 145-172
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0000392
Family	CCCH zinc finger	0.004
Further Details:

Weak hits

Sequence:	ENSCJAP00000029160
Domain Number -	Region: 38-59
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.000929
Family	CCCH zinc finger	0.0058
Further Details:

Domain Number -	Region: 119-143
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0034
Family	CCCH zinc finger	0.0069
Further Details:

Domain Number -	Region: 91-119
Classification Level	Classification	E-value
Superfamily	CCCH zinc finger	0.0275
Family	CCCH zinc finger	0.0058
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCJAP00000029160 Gene: ENSCJAG00000015826 Transcript: ENSCJAT00000030813
Sequence length	247
Comment	pep:known_by_projection chromosome:C_jacchus3.2.1:2:12474236:12486442:-1 gene:ENSCJAG00000015826 transcript:ENSCJAT00000030813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHI SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP LPQQTQPPAKQSNNPPLQRSSSLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPL EQVTCYK
Download sequence
Identical sequences	F7I7Y0 ENSCJAP00000029160 ENSCJAP00000029160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]