SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029161 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029161
Domain Number 1 Region: 2-33,173-249
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000455
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029161   Gene: ENSCJAG00000015817   Transcript: ENSCJAT00000030814
Sequence length 424
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:36892805:36912562:-1 gene:ENSCJAG00000015817 transcript:ENSCJAT00000030814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIITIPGVKIFQCCSSITFVNVYHLKHKLLKEVDMVRVPLKEEEIFTLFNSSDTNLQEQK
ICRCFCNCDDLEPLPRIVYTERFENKLAPKASSINLIHCSGFESVNTSQTSSEDQVPYTV
SSVSQKNQGQQLEEVENVLLPNNPSRNSLPGLPNMAESRGRSRSLIPSSDAPLLPSVHTI
ILDFSMVHYVDARGLVVLRQANICNAFHNSNILILIAGCHSSVVRTFERNDFFDAGITKA
QLFLSVHDAMLFALSRKVLDASELSIDESETVIQETYSETEKNDNSTYKMSNSFLGSQKN
VSPDFTKIQQPIEEESQLDLELESDQEAGLGLDLDLDQELEPESELEPEMELEPQPETET
ELEMEPNPKPRPRARPLPQRHYWPVYHPSVASTQSQTQPQSWSVGRRRHPMDSYSPKGNS
NEDV
Download sequence
Identical sequences F7I7X7
ENSCJAP00000029161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]