SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029174 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029174
Domain Number 1 Region: 546-578,718-792
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000377
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029174   Gene: ENSCJAG00000015817   Transcript: ENSCJAT00000030827
Sequence length 967
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:36892592:36996498:-1 gene:ENSCJAG00000015817 transcript:ENSCJAT00000030827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLERSTISGFSSKSTQNPFAYDIKREVYNEESFQQKHKRKASSSGNMDINITTFRHHV
QCRCSWHRFLRCMPTIFPFLEWMCMYRFKDWLLGDLLAGISVGLVQVSQGLTLSLLTRQL
IPPLNITYAAFCSSVIYVILGSCHQMSIGSFFLVSALLINVLKVSPFNNGHLIMGSFIKD
EVSTHSYLVGYNKSLSVVATTTFLTGIIQLIMGALGLGFIATYLPESATSAYLAAAALHI
MVSQLTYIFGTMITFHAGPISFFYNIINYCIALPKANSTSILLFLAVVVALRINKCIRIS
FNQYPIEFPMEFFLIIVFTVFANKISMATETSKMLIDMIPYSFLFPTTPDFSLLPNIILQ
AISLSLVSSFLLIFLGKKIASLHNYSVNSNQDLIAIGLCNVVSSFFRSSVFTGAVARTII
QDKSGGRQQFASLVGAGVMLLLMVKMGHFFYALPNAVLAGIILSNVYPYLETISNLPSLW
REDQYDCALWMMTFLSSVFLGLDIGLIISVVFAFFITTVRSHRMKIVLLGQIPNTNIYRN
VNDYREIITIPGVKIFQCCSSITFVNVYHLKHKLLKEVDMVRVPLKEEEIFTLFNSSDTN
LQEQKICRCFCNCDDLEPLPRIVYTERFENKLAPKASSINLIHCSGFESVNTSQTSSEDQ
VPYTVSSVSQKNQGQQLEEVENVLLPNNPSRNSLPGLPNMAESRGRSRSLIPSSDAPLLP
SVHTIILDFSMVHYVDARGLVVLRQICNAFHNSNILILIAGCHSSVVRTFERNDFFDAGI
TKAQLFLSVHDAMLFALSRKVLDASELSIDESETVIQETYSETEKNDNSTYKMSNSFLGS
QKNVSPDFTKIQQPIEEESQLDLELESDQEAGLGLDLDLDQELEPESELEPEMELEPQPE
TETELEMEPNPKPRPRARPLPQRHYWPVYHPSVASTQSQTQPQSWSVGRRRHPMDSYSPK
GNSNEDV
Download sequence
Identical sequences F7I5L1
XP_017826530.1.60252 ENSCJAP00000029148 ENSCJAP00000029174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]