SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029367 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000029367
Domain Number - Region: 393-476
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0342
Family PYP-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029367   Gene: ENSCJAG00000015942   Transcript: ENSCJAT00000031032
Sequence length 827
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:17448159:17830540:1 gene:ENSCJAG00000015942 transcript:ENSCJAT00000031032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPELAKKPPSRQKELLK
RKLEQQEKGKGHSFPRKGPGEVLPPGDRAAANSSRGKDVSRLPHARKTGGSSPETKYDQP
PKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWD
EDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKEKRSNYLHRQVL
QFSRQYGNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTN
DQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGG
SDWFLLNRKFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRI
TNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQL
DYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGE
NSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPPS
DFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPINVIA
ATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQPIKP
EEALKLHNGPLRNAYMEQSFQSLNPVLSLPISPAQVEQARRNAASTGTALEGWLDSLVGG
MWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
Download sequence
Identical sequences F7I7Q7
ENSCJAP00000029367 ENSCJAP00000029367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]