SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000029403 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000029403
Domain Number 1 Region: 130-199
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0000000432
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number 2 Region: 245-298
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.0000772
Family Hypothetical protein PA1324 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000029403
Domain Number - Region: 440-492
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000706
Family Carboxypeptidase regulatory domain 0.03
Further Details:      
 
Domain Number - Region: 808-867
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00165
Family Cna protein B-type domain 0.01
Further Details:      
 
Domain Number - Region: 51-115
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0051
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000029403   Gene: ENSCJAG00000015952   Transcript: ENSCJAT00000031070
Sequence length 879
Comment pep:novel chromosome:C_jacchus3.2.1:12:16416142:16487140:1 gene:ENSCJAG00000015952 transcript:ENSCJAT00000031070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLADRDAGPLGSVVVTAAVVLLLSGVGPVHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEKQKSVNILNNNLNTCDNIIDGYSIVYSQRSKKESLESVFQLLFLSA
IIRKDVLGCSVSPVPGFQLQDESLVYLCYTVSREDGSFSFYSLPSGGYTVVRIPFYRGER
ITLDVARSRLDFSVEHDSLKIEMLLHMCIIKIGHSENNGRETDGVKESSGEWKTRKQITS
EKDGGNIFIFSFKVHKSRDYERSLGMVLSVFVSHPFILKVHSRGMFSVCGQISIIRFPDT
VKQMSKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVIVPEAETRAGLTLKPQ
TFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKVNS
MTFTFDSVLPGRYKISIMHEDWCWKNKSLEVEVLEDDVSGVEFRQTGYMLRCSLSHAITL
EFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILTLT
AIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQERE
KNGKEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSMEAI
VSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIIISEKGASSPLITVFTDDKGAYSVGP
LHSDLEYTVTSQKEGYVLTAVEGTVGDFKAYALAGVSFE
Download sequence
Identical sequences F7I0L9
ENSCJAP00000029403 ENSCJAP00000029403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]