SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030126 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030126
Domain Number 1 Region: 439-471,552-626
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000118
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030126   Gene: ENSCJAG00000016357   Transcript: ENSCJAT00000031836
Sequence length 681
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:76307240:76357606:1 gene:ENSCJAG00000016357 transcript:ENSCJAT00000031836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGMAYALLAAVPVGYGLYSAFFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDE
HFLVSSSNGTVLNTTMIDVAARDTARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPL
VGGFTTAAAFQVLVSQLKIVLNVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFIAGLLTI
VICMAVKELNDRFRHKIPVPIPIEVIVTIIATAISYAANLEENYNAGIVKSIPRGFLPPA
LPPVSLFSEMLAASFSIAVVAYAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFS
CFVATTALSRTAVQESTGGKTQVAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLK
GMFMQVCDVPRLWRQNKTDAVIWVFTCIVSIILGLDLGLLAGLIFGLLTVVLRVQFPSWN
GLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVDGFKKCIKSTVGFDAIRVYN
KRLKALRKIQKLIKNGQLRATKNGIVSDAGSTNNAFEPDEDIEDLEELDIPTKEIEIRVD
WNSELPVKVNVPKVPIHSLVLDCGAISFLDIVGVKSLRVIVKEFQRIDVNVYFASLQDHV
IEKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQGGQDSILEAITFIQDCKDPLELI
EAELTEEELDVQDEAMRTLAT
Download sequence
Identical sequences F6WCD4
ENSCJAP00000046290 ENSCJAP00000030126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]