SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030204 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030204
Domain Number 1 Region: 526-558,639-713
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000706
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030204   Gene: ENSCJAG00000016400   Transcript: ENSCJAT00000031915
Sequence length 761
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:76400988:76450590:-1 gene:ENSCJAG00000016400 transcript:ENSCJAT00000031915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSTNAFEEEHKKRDRPHKTFLDHLKVCCSCSTQKAKRIVLSLLPI
ASWLPAYRFKEWLLSDIVSGISTGMVSVLQGLAFALLVTIPPVHGLYAAFFPIIVYLFFG
TSRHLSVGPFPILSTMVGIAVSRMVPDTSITTPELSNSSMSNGLNDSLLNDRKVVVAATV
SLFSGIIQLALGVLRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFILQLQVPSHTDPFS
IFKVLESIFTQIEKTNIADLVTGLIVLLVVFIVKEINQRFKDKLPAPIPIEFITTVIATG
VSYGFDFETRFNVSVVGNMEPGFMPPVTPDMRIIPDTIGDCFSIAIVAFAVAFSVASVYS
LKHDYPLDGNQELIALGLGNIVAGAFRGFSGSTALSRSAIQESTGGKTQIAGLISAIIVL
IVIVAIGFLLEPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIMTFILTIVL
GLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIYKNKKDYLDMYEPEGVKIFRCPS
PIYFANIGFFKQKLLDAVGFNPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDAIK
DSDEELDNNQIEVLNQPISTTDLPFQIDWNDLPLNIEVPRISLHSLILDFSAVSFLDVSS
MRGLKSILQEFIRIKVDVYIVGTDDDFVEKLTRCEFFDDEVKDSIFFLTIHDAVLHILMK
KDYSTSKFHSSQEKDGKMDFTINTNGGLRNREYQVPVETRF
Download sequence
Identical sequences F7BSM6
ENSCJAP00000030204 XP_002751788.1.60252 ENSCJAP00000030204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]