SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030388 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030388
Domain Number 1 Region: 8-118
Classification Level Classification E-value
Superfamily SRP19 1.06e-38
Family SRP19 0.000000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030388   Gene: ENSCJAG00000016512   Transcript: ENSCJAT00000032111
Sequence length 144
Comment pep:novel chromosome:C_jacchus3.2.1:2:94089993:94097228:-1 gene:ENSCJAG00000016512 transcript:ENSCJAT00000032111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACASARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTAAEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
KTGGGDPSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences F6V6L2
ENSCJAP00000030388 ENSCJAP00000030388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]