SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030481 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000030481
Domain Number 1 Region: 52-190
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-31
Family Phosphotyrosine-binding domain (PTB) 0.0000714
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000030481
Domain Number - Region: 2-32
Classification Level Classification E-value
Superfamily PH domain-like 0.000957
Family Phosphotyrosine-binding domain (PTB) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030481   Gene: ENSCJAG00000016553   Transcript: ENSCJAT00000032210
Sequence length 263
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:37453781:37459620:-1 gene:ENSCJAG00000016553 transcript:ENSCJAT00000032210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCHVFRCDVPAKAIASVLHGLCAQILSERIGVSGDASCCSPDPISPEDLPRQVELLDA
VSQAAQKYEALYMGTLPVTKAMGMDVLNEAIGALTARGDRNAWVPTTLSVSDSLMTAYPV
QAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQPHAGGLSEAV
QAACMVQYQKCLVASAARGKAWGAQARARLRLKRTSSMDSPGGPLPLPLLKGGVGSAGAT
PRKRGVFSFLDAFRLKPSLLHMP
Download sequence
Identical sequences F6ZPV1
ENSCJAP00000030481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]