SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000030508 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000030508
Domain Number - Region: 6-25,59-97
Classification Level Classification E-value
Superfamily Pseudouridine synthase 0.0223
Family Pseudouridine synthase RsuA/RluD 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000030508   Gene: ENSCJAG00000016578   Transcript: ENSCJAT00000032238
Sequence length 100
Comment pep:novel chromosome:C_jacchus3.2.1:15:63031124:63037007:-1 gene:ENSCJAG00000016578 transcript:ENSCJAT00000032238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLQLCPVLGDHTYSACVGTDLGQRFLLPAESTKPQTQVLDEALRRLQLTPSQAAQMPLH
LHLHWLLLPGTRARDTPIELLAPLPPYFSRTIQCLGLRLQ
Download sequence
Identical sequences F6YP69
ENSCJAP00000030508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]